DLX1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human DLX1 protein.
Immunogen
DLX1 (NP_835221.2, 1 a.a. ~ 255 a.a) full-length human protein.
Sequence
MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSASSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQQPQLM
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
DLX1 MaxPab rabbit polyclonal antibody. Western Blot analysis of DLX1 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of DLX1 expression in transfected 293T cell line (H00001745-T01) by DLX1 MaxPab polyclonal antibody.
Lane 1: DLX1 transfected lysate(27.30 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — DLX1
Entrez GeneID
1745GeneBank Accession#
NM_178120.4Protein Accession#
NP_835221.2Gene Name
DLX1
Gene Alias
-
Gene Description
distal-less homeobox 1
Omim ID
600029Gene Ontology
HyperlinkGene Summary
This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. The encoded protein may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain. This gene is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 2. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
Other Designations
OTTHUMP00000082494|OTTHUMP00000082497|distal-less homeo box 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com