DLST MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human DLST protein.
Immunogen
DLST (NP_001924.2, 1 a.a. ~ 453 a.a) full-length human protein.
Sequence
MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFFRTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (93)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
DLST MaxPab rabbit polyclonal antibody. Western Blot analysis of DLST expression in human kidney.Western Blot (Cell lysate)
DLST MaxPab rabbit polyclonal antibody. Western Blot analysis of DLST expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of DLST expression in transfected 293T cell line (H00001743-T02) by DLST MaxPab polyclonal antibody.
Lane 1: DLST transfected lysate(48.8 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of DLST transfected lysate using anti-DLST MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with DLST purified MaxPab mouse polyclonal antibody (B01P) (H00001743-B01P).Immunofluorescence
Immunofluorescence of purified MaxPab antibody to DLST on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — DLST
Entrez GeneID
1743GeneBank Accession#
NM_001933.3Protein Accession#
NP_001924.2Gene Name
DLST
Gene Alias
DLTS
Gene Description
dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
Omim ID
126063Gene Ontology
HyperlinkOther Designations
-
-
Interactome
-
Pathway
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Citrate cycle (TCA cycle)
- Lysine degradation
+ View More Disease
-
Disease
-
Publication Reference
-
Glutamine Anabolism Plays a Critical Role in Pancreatic Cancer by Coupling Carbon and Nitrogen Metabolism.
Bott AJ, Shen J, Tonelli C, Zhan L, Sivaram N, Jiang YP, Yu X, Bhatt V, Chiles E, Zhong H, Maimouni S, Dai W, Velasquez S, Pan JA, Muthalagu N, Morton J, Anthony TG, Feng H, Lamers WH, Murphy DJ, Guo JY, Jin J, Crawford HC, Zhang L, White E, Lin RZ, Su X, Tuveson DA, Zong WX.
Cell Reports 2019 Oct; 29(5):1287.
Application:WB-Tr, Mouse, KPC cells.
-
Glutamine Anabolism Plays a Critical Role in Pancreatic Cancer by Coupling Carbon and Nitrogen Metabolism.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com