DLST polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
DLST polyclonal antibody (A01), Lot # 060803QCS1. Western Blot analysis of DLST expression in U-2 OS.
Western Blot (Cell lysate)
DLST polyclonal antibody (A01), Lot # 051123JC01 Western Blot analysis of DLST expression in HeLa ( Cat # L013V1 ).
Western Blot detection against Immunogen (37 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant DLST.
Immunogen
DLST (NP_001924, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
Sequence
MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFFRTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (87); Rat (91)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DLST polyclonal antibody (A01), Lot # 060803QCS1. Western Blot analysis of DLST expression in U-2 OS.Western Blot (Cell lysate)
DLST polyclonal antibody (A01), Lot # 051123JC01 Western Blot analysis of DLST expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — DLST
-
Interactome
-
Pathway
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Citrate cycle (TCA cycle)
- Lysine degradation
+ View More Disease
-
Disease
-
Publication Reference
-
DLST-dependence dictates metabolic heterogeneity in TCA-cycle usage among triple-negative breast cancer.
Ning Shen, Sovannarith Korm, Theodoros Karantanos, Dun Li, Xiaoyu Zhang, Eleni Ritou, Hanfei Xu, Andrew Lam, Justin English, Wei-Xing Zong, Ching-Ti Liu, Orian Shirihai, Hui Feng.
Communications Biology 2021 Nov; 4(1):1289.
Application：WB-Ce, WB-Tr, Human, BT-549, CAMA-1, HCC1428, HCC1806, Hs 578T, MCF-7, MCF 10A, MDA-MB-231, MDA-MB-436, SUM159PT, T-47D, ZR-75-1 cells.
-
DLST-dependence dictates metabolic heterogeneity in TCA-cycle usage among triple-negative breast cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com