Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DLG3 monoclonal antibody (M03), clone 2B6

  • Catalog # : H00001741-M03
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant DLG3.
  • Immunogen:
  • DLG3 (NP_066943, 281 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • VNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPGSLHLNDMYAPPDYASTFTALADNHISHNSSLGYLGAVESKVSYPAPPQVPPTRYSPIPRHMLAEEDF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001741-M03
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of DLG3 expression in transfected 293T cell line by DLG3 monoclonal antibody (M03), clone 2B6.

    Lane 1: DLG3 transfected lysate(90.3 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • Western blot analysis of DLG3 over-expressed 293 cell line, cotransfected with DLG3 Validated Chimera RNAi ( Cat # H00001741-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with DLG3 monoclonal antibody (M03), clone 2B6 (Cat # H00001741-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 1741
  • Gene Name:
  • DLG3
  • Gene Alias:
  • KIAA1232,MRX,MRX90,NE-Dlg,NEDLG,SAP-102,SAP102
  • Gene Description:
  • discs, large homolog 3 (Drosophila)
  • Other Designations:
  • OTTHUMP00000023475,OTTHUMP00000023476,bA291O7.3 (discs, large Drosophila homolog 3 (neuroendocrine-dlg) ),discs large homolog 3,discs, large homolog 3 (neuroendocrine-dlg, Drosophila),neuroendocrine-dlg,synapse-associated protein 102
  • RSS
  • YouTube
  • Linkedin
  • Facebook