DLG3 monoclonal antibody (M03), clone 2B6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of DLG3 expression in transfected 293T cell line by DLG3 monoclonal antibody (M03), clone 2B6.
Lane 1: DLG3 transfected lysate(90.3 KDa).
Lane 2: Non-transfected lysate.
RNAi Knockdown (Antibody validated)
Western blot analysis of DLG3 over-expressed 293 cell line, cotransfected with DLG3 Validated Chimera RNAi ( Cat # H00001741-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with DLG3 monoclonal antibody (M03), clone 2B6 (Cat # H00001741-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant DLG3.
Immunogen
DLG3 (NP_066943, 281 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPGSLHLNDMYAPPDYASTFTALADNHISHNSSLGYLGAVESKVSYPAPPQVPPTRYSPIPRHMLAEEDF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DLG3 expression in transfected 293T cell line by DLG3 monoclonal antibody (M03), clone 2B6.
Lane 1: DLG3 transfected lysate(90.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of DLG3 over-expressed 293 cell line, cotransfected with DLG3 Validated Chimera RNAi ( Cat # H00001741-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with DLG3 monoclonal antibody (M03), clone 2B6 (Cat # H00001741-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — DLG3
Entrez GeneID
1741GeneBank Accession#
NM_021120Protein Accession#
NP_066943Gene Name
DLG3
Gene Alias
KIAA1232, MRX, MRX90, NE-Dlg, NEDLG, SAP-102, SAP102
Gene Description
discs, large homolog 3 (Drosophila)
Omim ID
300189Gene Ontology
HyperlinkGene Summary
O
Other Designations
OTTHUMP00000023475|OTTHUMP00000023476|bA291O7.3 (discs, large Drosophila homolog 3 (neuroendocrine-dlg) )|discs large homolog 3|discs, large homolog 3 (neuroendocrine-dlg, Drosophila)|neuroendocrine-dlg|synapse-associated protein 102
-
Interactomes
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com