Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DLG1 monoclonal antibody (M01A), clone 1D8

  • Catalog # : H00001739-M01A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant DLG1.
  • Immunogen:
  • DLG1 (NP_004078, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001739-M01A
    Western Blot detection against Immunogen (35.64 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1739
  • Gene Name:
  • DLG1
  • Gene Alias:
  • DKFZp761P0818,DKFZp781B0426,DLGH1,SAP-97,SAP97,dJ1061C18.1.1,hdlg
  • Gene Description:
  • discs, large homolog 1 (Drosophila)
  • Other Designations:
  • OTTHUMP00000165202,discs large homolog 1,discs, large homolog 1,presynaptic protein SAP97,synapse-associated protein 97
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook