DIAPH1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of DIAPH1 expression in transfected 293T cell line (H00001729-T02) by DIAPH1 MaxPab polyclonal antibody.
Lane 1: DIAPH1 transfected lysate(44.44 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human DIAPH1 protein.
Immunogen
DIAPH1 (AAH07411, 1 a.a. ~ 404 a.a) full-length human protein.
Sequence
MPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKDEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGEYFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVPAKVSKNSETFPTILEEAKELVGRAS
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (95)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DIAPH1 expression in transfected 293T cell line (H00001729-T02) by DIAPH1 MaxPab polyclonal antibody.
Lane 1: DIAPH1 transfected lysate(44.44 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — DIAPH1
Entrez GeneID
1729GeneBank Accession#
BC007411.1Protein Accession#
AAH07411Gene Name
DIAPH1
Gene Alias
DFNA1, DIA1, DRF1, FLJ25265, LFHL1, hDIA1
Gene Description
diaphanous homolog 1 (Drosophila)
Gene Ontology
HyperlinkGene Summary
This gene is a homolog of the Drosophila diaphanous gene, and has been linked to autosomal dominant, fully penetrant, nonsyndromic sensorineural progressive low-frequency hearing loss. Actin polymerization involves proteins known to interact with diaphanous protein in Drosophila and mouse. It has therefore been speculated that this gene may have a role in the regulation of actin polymerization in hair cells of the inner ear. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000195047|OTTHUMP00000195048|diaphanous 1|diaphanous-1|diaphanous-related formin 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com