DFNA5 monoclonal antibody (M01), clone 1E10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of DFNA5 expression in transfected 293T cell line by DFNA5 monoclonal antibody (M01), clone 1E10.
Lane 1: DFNA5 transfected lysate (Predicted MW: 54.6 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DFNA5 is 3 ng/ml as a capture antibody.
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DFNA5.
Immunogen
DFNA5 (NP_004394.1, 111 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SQSSFGTLRKQEVDLQQLIRDSAERTINLRNPVLQQVLEGRNEVLCVLTQKITTMQKCVISEHMQVEEKCGGIVGIQTKTVQVSATEDGN
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DFNA5 expression in transfected 293T cell line by DFNA5 monoclonal antibody (M01), clone 1E10.
Lane 1: DFNA5 transfected lysate (Predicted MW: 54.6 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DFNA5 is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — DFNA5
Entrez GeneID
1687GeneBank Accession#
NM_004403Protein Accession#
NP_004394.1Gene Name
DFNA5
Gene Alias
ICERE-1
Gene Description
deafness, autosomal dominant 5
Gene Ontology
HyperlinkGene Summary
Hearing impairment is a heterogeneous condition with over 40 loci described. The protein encoded by this gene is expressed in fetal cochlea, however, its function is not known. Nonsyndromic hearing impairment is associated with a mutation in this gene. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
Other Designations
deafness, autosomal dominant 5 protein|inversely correlated with estrogen receptor expression 1|nonsyndromic hearing impairment protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com