TIMM8A purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human TIMM8A protein.
Immunogen
TIMM8A (NP_004076.1, 1 a.a. ~ 97 a.a) full-length human protein.
Sequence
MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TIMM8A MaxPab polyclonal antibody. Western Blot analysis of TIMM8A expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of TIMM8A expression in transfected 293T cell line (H00001678-T01) by TIMM8A MaxPab polyclonal antibody.
Lane 1: TIMM8A transfected lysate(10.67 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to TIMM8A on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — TIMM8A
Entrez GeneID
1678GeneBank Accession#
NM_004085Protein Accession#
NP_004076.1Gene Name
TIMM8A
Gene Alias
DDP, DDP1, DFN1, MGC12262, MTS
Gene Description
translocase of inner mitochondrial membrane 8 homolog A (yeast)
Gene Ontology
HyperlinkGene Summary
This translocase is involved in the import and insertion of hydrophobic membrane proteins from the cytoplasm into the mitochondrial inner membrane. The gene is mutated in Mohr-Tranebjaerg syndrome/Deafness Dystonia Syndrome (MTS/DDS) and it is postulated that MTS/DDS is a mitochondrial disease caused by a defective mitochondrial protein import system. Defects in this gene also cause Jensen syndrome; an X-linked disease with opticoacoustic nerve atrophy and muscle weakness. This protein, along with TIMM13, forms a 70 kDa heterohexamer. Alternative splicing results in multiple transcript variants encoding distinct isoforms
Other Designations
OTTHUMP00000023681|deafness/dystonia peptide|translocase of inner mitochondrial membrane 8 homolog A
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com