Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TIMM8A MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00001678-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human TIMM8A protein.
  • Immunogen:
  • TIMM8A (NP_004076, 1 a.a. ~ 97 a.a) full-length human protein.
  • Sequence:
  • MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TIMM8A MaxPab polyclonal antibody. Western Blot analysis of TIMM8A expression in HepG2.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TIMM8A expression in transfected 293T cell line (H00001678-T01) by TIMM8A MaxPab polyclonal antibody.

    Lane 1: TIMM8A transfected lysate(10.67 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 1678
  • Gene Name:
  • TIMM8A
  • Gene Alias:
  • DDP,DDP1,DFN1,MGC12262,MTS
  • Gene Description:
  • translocase of inner mitochondrial membrane 8 homolog A (yeast)
  • Gene Summary:
  • This translocase is involved in the import and insertion of hydrophobic membrane proteins from the cytoplasm into the mitochondrial inner membrane. The gene is mutated in Mohr-Tranebjaerg syndrome/Deafness Dystonia Syndrome (MTS/DDS) and it is postulated that MTS/DDS is a mitochondrial disease caused by a defective mitochondrial protein import system. Defects in this gene also cause Jensen syndrome; an X-linked disease with opticoacoustic nerve atrophy and muscle weakness. This protein, along with TIMM13, forms a 70 kDa heterohexamer. Alternative splicing results in multiple transcript variants encoding distinct isoforms
  • Other Designations:
  • OTTHUMP00000023681,deafness/dystonia peptide,translocase of inner mitochondrial membrane 8 homolog A
  • RSS
  • YouTube
  • Linkedin
  • Facebook