Product Browser

Last updated: 2017/6/25
  • Related Product Showcase
  • By Pathway

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DFFB polyclonal antibody (A01)

  • Catalog # : H00001677-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant DFFB.
  • Immunogen:
  • DFFB (NP_004393, 229 a.a. ~ 338 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • PFDMDSCLSRHSINPYSNRESRILFSTWNLDHIIEKKRTIIPTLVEAIKEQDGREVDWEYFYGLLFTSENLKLVHIVCHKKTTHKLNCDPSRIYKPQTRLKRKQPVRKRQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001677-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • DFFB polyclonal antibody (A01), Lot # 050928JC01. Western Blot analysis of DFFB expression in Daoy.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1677
  • Gene Name:
  • DFFB
  • Gene Alias:
  • CAD,CPAN,DFF-40,DFF2,DFF40
  • Gene Description:
  • DNA fragmentation factor, 40kDa, beta polypeptide (caspase-activated DNase)
  • Gene Summary:
  • Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene but the biological validity of these variants has not been determined. [provided by RefSeq
  • Other Designations:
  • DNA fragmentation factor, 40 kD, beta polypeptide,DNA fragmentation factor, 40 kD, beta polypeptide (caspase-activated DNase),DNA fragmentation factor, 40 kD, beta subunit,OTTHUMP00000003633,caspase-activated deoxyribonuclease,caspase-activated nuclease
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook