DFFA monoclonal antibody (M05), clone 3A11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of DFFA expression in transfected 293T cell line by DFFA monoclonal antibody (M05), clone 3A11.
Lane 1: DFFA transfected lysate (Predicted MW: 36.5 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DFFA is 0.1 ng/ml as a capture antibody.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CASP3 and DFFA. HeLa cells were stained with anti-CASP3 rabbit purified polyclonal 1:1200 and anti-DFFA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot detection against Immunogen (36.85 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DFFA.
Immunogen
DFFA (NP_004392.1, 231 a.a. ~ 331 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACERELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.85 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DFFA expression in transfected 293T cell line by DFFA monoclonal antibody (M05), clone 3A11.
Lane 1: DFFA transfected lysate (Predicted MW: 36.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DFFA is 0.1 ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CASP3 and DFFA. HeLa cells were stained with anti-CASP3 rabbit purified polyclonal 1:1200 and anti-DFFA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — DFFA
Entrez GeneID
1676GeneBank Accession#
NM_004401Protein Accession#
NP_004392.1Gene Name
DFFA
Gene Alias
DFF-45, DFF1, ICAD
Gene Description
DNA fragmentation factor, 45kDa, alpha polypeptide
Omim ID
601882Gene Ontology
HyperlinkGene Summary
Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
Other Designations
DFF45|DNA fragmentation factor, 45 kD, alpha polypeptide|DNA fragmentation factor, 45 kD, alpha subunit|OTTHUMP00000001903|OTTHUMP00000001904
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com