Product Browser

Last updated: 2017/2/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DEFB4 (Human) Recombinant Protein (Q01)

  • Catalog # : H00001673-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DEFB4 partial ORF ( NP_004933, 24 a.a. - 64 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 30.25
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001673-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1673
  • Gene Name:
  • DEFB4
  • Gene Alias:
  • DEFB-2,DEFB102,DEFB2,HBD-2,SAP1
  • Gene Description:
  • defensin, beta 4
  • Gene Summary:
  • Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 4, an antibiotic peptide which is locally regulated by inflammation. [provided by RefSeq
  • Other Designations:
  • defensin, beta 2,skin-antimicrobial peptide 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook