DEFA6 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of DEFA6 expression in transfected 293T cell line (H00001671-T01) by DEFA6 MaxPab polyclonal antibody.
Lane 1: DEFA6 transfected lysate(11.00 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human DEFA6 protein.
Immunogen
DEFA6 (NP_001917.1, 1 a.a. ~ 100 a.a) full-length human protein.
Sequence
MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DEFA6 expression in transfected 293T cell line (H00001671-T01) by DEFA6 MaxPab polyclonal antibody.
Lane 1: DEFA6 transfected lysate(11.00 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — DEFA6
Entrez GeneID
1671GeneBank Accession#
NM_001926.2Protein Accession#
NP_001917.1Gene Name
DEFA6
Gene Alias
DEF6, HD-6
Gene Description
defensin, alpha 6, Paneth cell-specific
Omim ID
600471Gene Ontology
HyperlinkGene Summary
Defensins are a family of microbicidal and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 6, is highly expressed in the secretory granules of Paneth cells of the small intestine, and likely plays a role in host defense of human bowel. [provided by RefSeq
Other Designations
defensin 6|defensin, alpha 6
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com