DEFA3 monoclonal antibody (M01), clone 1A9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of DEFA3 expression in transfected 293T cell line by DEFA3 monoclonal antibody (M01), clone 1A9.
Lane 1: DEFA3 transfected lysate (Predicted MW: 10.2 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DEFA3 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.6 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant DEFA3.
Immunogen
DEFA3 (NP_005208.1, 1 a.a. ~ 94 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.6 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DEFA3 expression in transfected 293T cell line by DEFA3 monoclonal antibody (M01), clone 1A9.
Lane 1: DEFA3 transfected lysate (Predicted MW: 10.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DEFA3 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — DEFA3
Entrez GeneID
1668GeneBank Accession#
NM_005217.2Protein Accession#
NP_005208.1Gene Name
DEFA3
Gene Alias
DEF3, HNP-3, HNP3, HP-3
Gene Description
defensin, alpha 3, neutrophil-specific
Omim ID
604522Gene Ontology
HyperlinkGene Summary
Defensins are a family of microbicidal and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 3, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. It differs from defensin, alpha 1 by only one amino acid. [provided by RefSeq
Other Designations
defensin 3, neutrophil-specific|defensin, alpha 3|neutrophil peptide 3
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com