DEFA1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human DEFA1 full-length ORF ( AAH27917, 1 a.a. - 94 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKSMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.08
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — DEFA1
Entrez GeneID
1667GeneBank Accession#
BC027917Protein Accession#
AAH27917Gene Name
DEFA1
Gene Alias
DEF1, DEFA2, HNP-1, HP-1, MGC138393, MRS
Gene Description
defensin, alpha 1
Omim ID
125220Gene Ontology
HyperlinkGene Summary
Defensins are a family of microbicidal and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 1, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. It differs from defensin, alpha 3 by only one amino acid. [provided by RefSeq
Other Designations
OTTHUMP00000196017|defensin, alpha 1, myeloid-related sequence|defensin, alpha 2|myeloid-related sequence
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com