DDX11 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant DDX11.
Immunogen
DDX11 (AAH11264, 40 a.a. ~ 129 a.a) partial recombinant protein with GST tag.
Sequence
GIFESPTGTGKSLSLICGALSWLRDFEQKKREEEARLLETGTGPLHDEKDESLCLSSSCEGAAGTPRPAGEPAWVTQFVQKKEERDLVDR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (74)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.01 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DDX11 polyclonal antibody (A01), Lot # 051017JC01 Western Blot analysis of DDX11 expression in Y-79 ( Cat # L042V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — DDX11
Entrez GeneID
1663GeneBank Accession#
BC011264Protein Accession#
AAH11264Gene Name
DDX11
Gene Alias
CHL1, CHLR1, KRG2, MGC133249, MGC9335
Gene Description
DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11 (CHL1-like helicase homolog, S. cerevisiae)
Omim ID
601150Gene Ontology
HyperlinkGene Summary
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is an enzyme that possesses both ATPase and DNA helicase activities. This gene is a homolog of the yeast CHL1 gene, and may function to maintain chromosome transmission fidelity and genome stability. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq
Other Designations
CHL1-related helicase gene-1|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11|keratinocyte growth factor-regulated gene 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com