Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DHX9 (Human) Recombinant Protein (Q01)

  • Catalog # : H00001660-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DHX9 partial ORF ( NP_001348, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.64
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001660-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1660
  • Gene Name:
  • DHX9
  • Gene Alias:
  • DDX9,LKP,NDHII,RHA
  • Gene Description:
  • DEAH (Asp-Glu-Ala-His) box polypeptide 9
  • Gene Summary:
  • DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression. It contains 2 copies of a double-stranded RNA-binding domain, a DEXH core domain and an RGG box. The RNA-binding domains and RGG box influence and regulate RNA helicase activity. [provided by RefSeq
  • Other Designations:
  • ATP-dependent RNA helicase A,DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9 (RNA helicase A),DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9 (RNA helicase A, nuclear DNA helicase II; leukophysin),DEAD/H box-9 (nuclear DNA helicase II; RNA helicase A),OTTHU
  • RSS
  • YouTube
  • Linkedin
  • Facebook