DHX9 monoclonal antibody (M01), clone 3G7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DHX9.
Immunogen
DHX9 (NP_001348, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (89)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DHX9 monoclonal antibody (M01), clone 3G7 Western Blot analysis of DHX9 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to DHX9 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to DHX9 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — DHX9
Entrez GeneID
1660GeneBank Accession#
NM_001357Protein Accession#
NP_001348Gene Name
DHX9
Gene Alias
DDX9, LKP, NDHII, RHA
Gene Description
DEAH (Asp-Glu-Ala-His) box polypeptide 9
Omim ID
603115Gene Ontology
HyperlinkGene Summary
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression. It contains 2 copies of a double-stranded RNA-binding domain, a DEXH core domain and an RGG box. The RNA-binding domains and RGG box influence and regulate RNA helicase activity. [provided by RefSeq
Other Designations
ATP-dependent RNA helicase A|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9 (RNA helicase A)|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9 (RNA helicase A, nuclear DNA helicase II; leukophysin)|DEAD/H box-9 (nuclear DNA helicase II; RNA helicase A)|OTTHU
-
Interactome
-
Disease
-
Publication Reference
-
Roles of the Linker Region of RNA Helicase A in HIV-1 RNA Metabolism.
Xing L, Niu M, Zhao X, Kleiman L.
PLoS One 2013 Nov; 8(11):e78596.
Application:WB-Tr, Human, 293T cells.
-
Cellular RNA Binding Proteins NS1-BP and hnRNP K Regulate Influenza A Virus RNA Splicing.
Tsai PL, Chiou NT, Kuss S, Garcia-Sastre A, Lynch KW, Fontoura BM.
PLoS Pathogens 2013 Jun; 9(6):e1003460.
Application:WB, Human, HeLa cells.
-
In vitro and in vivo analysis of the interaction between RNA helicase A and HIV-1 RNA.
Xing L, Niu M, Kleiman L.
Journal of Virology 2012 Dec; 86(24):13272.
Application:WB-Tr, Human, HEK 293T cells.
-
Coordinate roles of Gag and RNA helicase A in promoting the annealing of tRNALys3 to HIV-1 RNA.
Xing L, Liang C, Kleiman L.
Journal of Virology 2011 Feb; 85(4):1847.
Application:WB-Tr, Human, 293T cells.
-
Functional proteomic analysis of promyelocytic leukaemia nuclear bodies in irradiation-induced MCF-7 cells.
Liu J, Song Y, Tian B, Qian J, Dong Y, Liu J, Liu B, Sun Z.
Journal of Biochemistry 2010 Dec; 148(6):659.
Application:WB-Ce, Human, MCF-7 cells.
-
RNA helicase A interacts with RISC in human cells and functions in RISC loading.
Robb GB, Rana TM.
Molecular Cell 2007 May; 26(4):523.
Application:WB-Tr, Human, HeLa, HEK 293T cells.
-
Roles of the Linker Region of RNA Helicase A in HIV-1 RNA Metabolism.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com