DHX8 monoclonal antibody (M01), clone 1E10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
DHX8 monoclonal antibody (M01), clone 1E10 Western Blot analysis of DHX8 expression in Hela S3 NE ( Cat # L013V3 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DHX8 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DHX8.
Immunogen
DHX8 (NP_004932, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKW
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DHX8 monoclonal antibody (M01), clone 1E10 Western Blot analysis of DHX8 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DHX8 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — DHX8
Entrez GeneID
1659GeneBank Accession#
NM_004941Protein Accession#
NP_004932Gene Name
DHX8
Gene Alias
DDX8, HRH1, PRP22, PRPF22
Gene Description
DEAH (Asp-Glu-Ala-His) box polypeptide 8
Omim ID
600396Gene Ontology
HyperlinkGene Summary
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is highly homologous to yeast Prp22. This protein facilitates nuclear export of spliced mRNA by releasing the RNA from the spliceosome. [provided by RefSeq
Other Designations
DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 8 (RNA helicase)|DEAH-box protein 8
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com