Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AKR1C1 (Human) Recombinant Protein (P01)

  • Catalog # : H00001645-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human AKR1C1 full-length ORF ( NP_001344.2, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 63.2
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001645-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1645
  • Gene Name:
  • AKR1C1
  • Gene Alias:
  • 2-ALPHA-HSD,20-ALPHA-HSD,C9,DD1,DDH,DDH1,H-37,HAKRC,MBAB,MGC8954
  • Gene Description:
  • aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase)
  • Gene Summary:
  • This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reaction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. [provided by RefSeq
  • Other Designations:
  • 20 alpha-hydroxysteroid dehydrogenase,OTTHUMP00000018992,aldo-keto reductase C,aldo-keto reductase family 1, member C1,chlordecone reductase homolog,dihydrodiol dehydrogenase 1,dihydrodiol dehydrogenase isoform DD1,hepatic dihydrodiol dehydrogenase,trans-
  • RSS
  • YouTube
  • Linkedin
  • Facebook