Product Browser

Last updated: 2017/1/22
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AKR1C1 polyclonal antibody (A01)

  • Catalog # : H00001645-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant AKR1C1.
  • Immunogen:
  • AKR1C1 (AAH20216, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001645-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • AKR1C1 polyclonal antibody (A01), Lot # 070510JCS1 Western Blot analysis of AKR1C1 expression in HeLa ( Cat # L013V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1645
  • Gene Name:
  • AKR1C1
  • Gene Alias:
  • 2-ALPHA-HSD,20-ALPHA-HSD,C9,DD1,DDH,DDH1,H-37,HAKRC,MBAB,MGC8954
  • Gene Description:
  • aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase)
  • Gene Summary:
  • This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reaction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. [provided by RefSeq
  • Other Designations:
  • 20 alpha-hydroxysteroid dehydrogenase,OTTHUMP00000018992,aldo-keto reductase C,aldo-keto reductase family 1, member C1,chlordecone reductase homolog,dihydrodiol dehydrogenase 1,dihydrodiol dehydrogenase isoform DD1,hepatic dihydrodiol dehydrogenase,trans-
  • RSS
  • YouTube
  • Linkedin
  • Facebook