DCTD monoclonal antibody (M01), clone 4B9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DCTD.
Immunogen
DCTD (NP_001912.2, 69 a.a. ~ 178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ
Host
Mouse
Reactivity
Human
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DCTD expression in transfected 293T cell line by DCTD monoclonal antibody (M01), clone 4B9.
Lane 1: DCTD transfected lysate(20.016 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to DCTD on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DCTD is 0.03 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of DCTD over-expressed 293 cell line, cotransfected with DCTD Validated Chimera RNAi ( Cat # H00001635-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with DCTD monoclonal antibody (M01), clone 4B9 (Cat # H00001635-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — DCTD
Entrez GeneID
1635GeneBank Accession#
NM_001921.2Protein Accession#
NP_001912.2Gene Name
DCTD
Gene Alias
MGC111062
Gene Description
dCMP deaminase
Omim ID
607638Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses zinc as a cofactor for its activity. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
deoxycytidylate deaminase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com