Product Browser

Last updated: 2017/4/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DBI (Human) Recombinant Protein (P01)

  • Catalog # : H00001622-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DBI full-length ORF ( NP_065438.1, 1 a.a. - 104 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 38.2
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001622-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1622
  • Gene Name:
  • DBI
  • Gene Alias:
  • ACBD1,ACBP,CCK-RP,EP,MGC70414
  • Gene Description:
  • diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein)
  • Gene Summary:
  • This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
  • Other Designations:
  • GABA receptor modulator,acyl coenzyme A binding protein,acyl-Coenzyme A binding domain containing 1,cholecystokinin-releasing peptide, trypsin-sensitive,diazepam binding inhibitor,diazepam binding inhibitor, splice form 1c,endozepine
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook