Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DBC1 polyclonal antibody (A01)

  • Catalog # : H00001620-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant DBC1.
  • Immunogen:
  • DBC1 (NP_055433, 662 a.a. ~ 761 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LRFNADLLRSAVQQVNQSYTQGGQFYSSSSVMLLLLDIRDRINRLAPPVAPGKPQLDLFSCMLKHRLKLTNSEIIRVNHALDLYNTEILKQSDQMTAKLC
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001620-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1620
  • Gene Name:
  • DBC1
  • Gene Alias:
  • DBCCR1,FAM5A
  • Gene Description:
  • deleted in bladder cancer 1
  • Gene Summary:
  • This gene is located within a chromosomal region that shows loss of heterozygosity in some bladder cancers. It contains a 5' CpG island that may be a frequent target of hypermethylation, and it may undergo hypermethylation-based silencing in some bladder cancers. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022751,bA574M5.1 (deleted in bladder cancer chromosome region candidate 1 (IB3089A)),deleted in bladder cancer chromosome region candidate 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook