DAXX monoclonal antibody (M03), clone 4C2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DAXX.
Immunogen
DAXX (NP_001341, 561 a.a. ~ 660 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVERQRSVHEKNG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (63); Rat (58)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DAXX expression in transfected 293T cell line by DAXX monoclonal antibody (M03), clone 4C2.
Lane 1: DAXX transfected lysate(81.373 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DAXX is approximately 1ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between TGFB1 and DAXX. HeLa cells were stained with anti-TGFB1 rabbit purified polyclonal 1:1200 and anti-DAXX mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to DAXX on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — DAXX
Entrez GeneID
1616GeneBank Accession#
NM_001350Protein Accession#
NP_001341Gene Name
DAXX
Gene Alias
BING2, DAP6, EAP1, MGC126245, MGC126246
Gene Description
death-domain associated protein
Omim ID
603186Gene Ontology
HyperlinkGene Summary
This gene encodes a multifunctional protein that resides in multiple locations in the nucleus and in the cytoplasm. It interacts with a wide variety of proteins, such as apoptosis antigen Fas, centromere protein C, and transcription factor erythroblastosis virus E26 oncogene homolog 1. In the nucleus, the encoded protein functions as a potent transcription repressor that binds to sumoylated transcription factors. Its repression can be relieved by the sequestration of this protein into promyelocytic leukemia nuclear bodies or nucleoli. This protein also associates with centromeres in G2 phase. In the cytoplasm, the encoded protein may function to regulate apoptosis. The subcellular localization and function of this protein are modulated by post-translational modifications, including sumoylation, phosphorylation and polyubiquitination. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
CENP-C binding protein|ETS1-associated protein 1|Fas-binding protein|OTTHUMP00000029289|OTTHUMP00000029290|death-associated protein 6
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com