DARS monoclonal antibody (M01), clone 2F11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
DARS monoclonal antibody (M01), clone 2F11 Western Blot analysis of DARS expression in HeLa ( Cat # L013V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of DARS expression in transfected 293T cell line by DARS monoclonal antibody (M01), clone 2F11.
Lane 1: DARS transfected lysate(57.1 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to DARS on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DARS is approximately 0.3ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of DARS over-expressed 293 cell line, cotransfected with DARS Validated Chimera RNAi ( Cat # H00001615-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with DARS monoclonal antibody (M01), clone 2F11 (Cat # H00001615-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (37.62 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DARS.
Immunogen
DARS (NP_001340, 393 a.a. ~ 500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KYPLAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPKRLT
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DARS monoclonal antibody (M01), clone 2F11 Western Blot analysis of DARS expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of DARS expression in transfected 293T cell line by DARS monoclonal antibody (M01), clone 2F11.
Lane 1: DARS transfected lysate(57.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to DARS on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DARS is approximately 0.3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of DARS over-expressed 293 cell line, cotransfected with DARS Validated Chimera RNAi ( Cat # H00001615-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with DARS monoclonal antibody (M01), clone 2F11 (Cat # H00001615-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — DARS
Entrez GeneID
1615GeneBank Accession#
NM_001349Protein Accession#
NP_001340Gene Name
DARS
Gene Alias
DKFZp781B11202, MGC111579
Gene Description
aspartyl-tRNA synthetase
Omim ID
603084Gene Ontology
HyperlinkGene Summary
Aspartyl-tRNA synthetase (DARS) is part of a multienzyme complex of aminoacyl-tRNA synthetases. Aspartyl-tRNA synthetase charges its cognate tRNA with aspartate during protein biosynthesis. [provided by RefSeq
Other Designations
aspartate tRNA ligase 1, cytoplasmic|cell proliferation-inducing protein 40
-
Interactome
-
Pathway
-
Publication Reference
-
Proteomic identification of putative biomarkers of radiotherapy resistance: a possible role for the 26S proteasome?
Smith L, Qutob O, Watson MB, Beavis AW, Potts D, Welham KJ, Garimella V, Lind MJ, Drew PJ, Cawkwell L.
Neoplasia 2009 Nov; 11(11):1194.
Application：WB-Ce, Human, MCF-7, MDA-MB-231, T-47D cells.
-
Proteomic identification of putative biomarkers of radiotherapy resistance: a possible role for the 26S proteasome?
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com