DAG1 monoclonal antibody (M01), clone 2A3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DAG1.
Immunogen
DAG1 (AAH12740, 31 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
WPSEPSEAVRDWENQLEASMHSVLSDLHEAVPTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHTLEGLPLDTDKGVHYISVSATRLGA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (92)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DAG1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — DAG1
Entrez GeneID
1605GeneBank Accession#
BC012740Protein Accession#
AAH12740Gene Name
DAG1
Gene Alias
156DAG, A3a, AGRNR, DAG
Gene Description
dystroglycan 1 (dystrophin-associated glycoprotein 1)
Omim ID
128239Gene Ontology
HyperlinkGene Summary
Dystroglycan is a laminin binding component of the dystrophin-glycoprotein complex which provides a linkage between the subsarcolemmal cytoskeleton and the extracellular matrix. Dystroglycan 1 is a candidate gene for the site of the mutation in autosomal recessive muscular dystrophies. The dramatic reduction of dystroglycan 1 in Duchenne muscular dystrophy leads to a loss of linkage between the sarcolemma and extracellular matrix, rendering muscle fibers more susceptible to necrosis. Dystroglycan also functions as dual receptor for agrin and laminin-2 in the Schwann cell membrane. The muscle and nonmuscle isoforms of dystroglycan differ by carbohydrate moieties but not protein sequence. Alternative splicing results in multiple transcript variants
Other Designations
alpha-dystroglycan|beta-dystroglycan|dystroglycan 1|dystrophin-associated glycoprotein-1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Type 2 Diabetes Biomarkers and Uses Thereof.
Eustache Paramithiotis, Marc Prentki, Rèmi Rabasa-lhoret, Pascal Croteau, Joel Lanoix, Murthy S. R. Madiraju, Érik Joly
United States Patent Application Publication 2015 Nov; [Epub].
Application:IF, WB, Human, Mouse, Rat, Islets, INS832/13, MIN6 cells.
-
The N-terminal domain of ?-dystroglycan, released as a 38kDa protein, is increased in cerebrospinal fluid in patients with Lyme neuroborreliosis.
Hesse C, Johansson I, Mattsson N, Bremell D, Andreasson U, Halim A, Anckarsater R, Blennow K, Anckarsater H, Zetterberg H, Larson G, Hagberg L, Grahn A.
Biochemical and Biophysical Research Communications 2011 Sep; 412(3):494.
Application:ELISA, As a standard.
-
Type 2 Diabetes Biomarkers and Uses Thereof.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com