CYP51A1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant CYP51A1.
Immunogen
CYP51A1 (NP_000777, 410 a.a. ~ 509 a.a) partial recombinant protein with GST tag.
Sequence
SPTVNQRLKDSWVERLDFNPDRYLQDNPASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFDLIDGYFPTVNYTTMIHTPENPVIRYKRRSK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (98)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — CYP51A1
Entrez GeneID
1595GeneBank Accession#
NM_000786Protein Accession#
NP_000777Gene Name
CYP51A1
Gene Alias
CP51, CYP51, CYPL1, LDM, P450-14DM, P450L1
Gene Description
cytochrome P450, family 51, subfamily A, polypeptide 1
Omim ID
601637Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein participates in the synthesis of cholesterol by catalyzing the removal of the 14alpha-methyl group from lanosterol. Homologous genes are found in all three eukaryotic phyla, fungi, plants, and animals, suggesting that this is one of the oldest cytochrome P450 genes. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
cytochrome P450, 51 (lanosterol 14-alpha-demethylase)|cytochrome P450, family 51|lanosterol 14-alpha-demethylase|sterol 14-alpha demethylase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Amyloid precursor protein α- and β-cleaved ectodomains exert opposing control of cholesterol homeostasis via SREBP2.
Wang W, Mutka AL, Zmrzljak UP, Rozman D, Tanila H, Gylling H, Remes AM, Huttunen HJ, Ikonen E.
FASEB Journal 2014 Feb; 28(2):849.
Application:WB-Tr, Human, U251MG cells.
-
Variation of cholesterol contents in porcine cumulus-oocyte complexes is a key factor in regulation of fertilizing capacity.
Watanabe H, Hirai S, Tateno H, Fukui Y.
Theriogenology 2012 Dec; 79(4):680.
Application:IHC-P, Pig, Porcine ovaries.
-
Amyloid precursor protein α- and β-cleaved ectodomains exert opposing control of cholesterol homeostasis via SREBP2.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com