Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CYP27B1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00001594-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CYP27B1 partial ORF ( NP_000776, 409 a.a. - 508 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TLCHYATSRDPAQFPEPNSFRPARWLGEGPTPHPFASLPFGFGKRSCMGRRLAELELQMALAQILTHFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001594-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1594
  • Gene Name:
  • CYP27B1
  • Gene Alias:
  • CP2B,CYP1,CYP1alpha,CYP27B,P450c1,PDDR,VDD1,VDDR,VDDRI,VDR
  • Gene Description:
  • cytochrome P450, family 27, subfamily B, polypeptide 1
  • Gene Summary:
  • This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the inner mitochondrial membrane where it hydroxylates 25-hydroxyvitamin D3 at the 1alpha position. This reaction synthesizes 1alpha,25-dihydroxyvitamin D3, the active form of vitamin D3, which binds to the vitamin D receptor and regulates calcium metabolism. Thus this enzyme regulates the level of biologically active vitamin D and plays an important role in calcium homeostasis. Mutations in this gene can result in vitamin D-dependent rickets type I. [provided by RefSeq
  • Other Designations:
  • 1alpha(OH)ase,25 hydroxyvitamin D3-1-alpha hydroxylase,25-Hydroxyvitamin D3 1alpha-hydroxylase,25-OHD-1 alpha-hydroxylase,25-hydroxyvitamin D-1-alpha-hydroxylase,P450C1-alpha,P450VD1-alpha,VD3 1A hydroxylase,VDDR I,calcidiol 1-monooxygenase,cytochrome P45
  • RSS
  • YouTube
  • Linkedin
  • Facebook