CYP27A1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
CYP27A1 MaxPab polyclonal antibody. Western Blot analysis of CYP27A1 expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of CYP27A1 expression in transfected 293T cell line (H00001593-T01) by CYP27A1 MaxPab polyclonal antibody.
Lane 1: CYP27A1 transfected lysate(58.41 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CYP27A1 protein.
Immunogen
CYP27A1 (NP_000775.1, 1 a.a. ~ 531 a.a) full-length human protein.
Sequence
MAALGCARLRWALRGAGRGLCPHGARAKAAIPAALPSDKATGAPGAGPGVRRRQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAAGPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEALHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPKNTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (72); Rat (73)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CYP27A1 MaxPab polyclonal antibody. Western Blot analysis of CYP27A1 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of CYP27A1 expression in transfected 293T cell line (H00001593-T01) by CYP27A1 MaxPab polyclonal antibody.
Lane 1: CYP27A1 transfected lysate(58.41 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CYP27A1
Entrez GeneID
1593GeneBank Accession#
NM_000784.2Protein Accession#
NP_000775.1Gene Name
CYP27A1
Gene Alias
CP27, CTX, CYP27
Gene Description
cytochrome P450, family 27, subfamily A, polypeptide 1
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body, this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis, a rare autosomal recessive lipid storage disease. [provided by RefSeq
Other Designations
5-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 26-hydroxylase|5-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 27-hydroxylase|cholestanetriol 26-monooxygenase|cytochrome P-450C27/25|cytochrome P450, subfamily XXVIIA (steroid 27-hydroxylase, cerebrot
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com