CYP24A1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CYP24A1 partial ORF ( NP_000773, 415 a.a. - 514 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Interspecies Antigen Sequence
Mouse (84); Rat (86)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CYP24A1
Entrez GeneID
1591GeneBank Accession#
NM_000782Protein Accession#
NP_000773Gene Name
CYP24A1
Gene Alias
CP24, CYP24, MGC126273, MGC126274, P450-CC24
Gene Description
cytochrome P450, family 24, subfamily A, polypeptide 1
Omim ID
126065Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein initiates the degradation of 1,25-dihydroxyvitamin D3, the physiologically active form of vitamin D3, by hydroxylation of the side chain. In regulating the level of vitamin D3, this enzyme plays a role in calcium homeostasis and the vitamin D endocrine system. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
1,25-@dihydroxyvitamin D3 24-hydroxylase|24-OHase|OTTHUMP00000031314|cytochrome P450 family 24 subfamily A polypeptide 1|cytochrome P450, subfamily XXIV (vitamin D 24-hydroxylase)|exo-mitochondrial protein|vitamin D 24-hydroxylase
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com