Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CYP24A1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00001591-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CYP24A1 partial ORF ( NP_000773, 415 a.a. - 514 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001591-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1591
  • Gene Name:
  • CYP24A1
  • Gene Alias:
  • CP24,CYP24,MGC126273,MGC126274,P450-CC24
  • Gene Description:
  • cytochrome P450, family 24, subfamily A, polypeptide 1
  • Gene Summary:
  • This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein initiates the degradation of 1,25-dihydroxyvitamin D3, the physiologically active form of vitamin D3, by hydroxylation of the side chain. In regulating the level of vitamin D3, this enzyme plays a role in calcium homeostasis and the vitamin D endocrine system. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • 1,25-@dihydroxyvitamin D3 24-hydroxylase,24-OHase,OTTHUMP00000031314,cytochrome P450 family 24 subfamily A polypeptide 1,cytochrome P450, subfamily XXIV (vitamin D 24-hydroxylase),exo-mitochondrial protein,vitamin D 24-hydroxylase
  • RSS
  • YouTube
  • Linkedin
  • Facebook