CYP24A1 monoclonal antibody (M07), clone 1F8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CYP24A1 expression in transfected 293T cell line by CYP24A1 monoclonal antibody (M07), clone 1F8.
Lane 1: CYP24A1 transfected lysate (Predicted MW: 11.11 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CYP24A1 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CYP24A1.
Immunogen
CYP24A1 (NP_000773, 415 a.a. ~ 514 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (86)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CYP24A1 expression in transfected 293T cell line by CYP24A1 monoclonal antibody (M07), clone 1F8.
Lane 1: CYP24A1 transfected lysate (Predicted MW: 11.11 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CYP24A1 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — CYP24A1
Entrez GeneID
1591GeneBank Accession#
NM_000782Protein Accession#
NP_000773Gene Name
CYP24A1
Gene Alias
CP24, CYP24, MGC126273, MGC126274, P450-CC24
Gene Description
cytochrome P450, family 24, subfamily A, polypeptide 1
Omim ID
126065Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein initiates the degradation of 1,25-dihydroxyvitamin D3, the physiologically active form of vitamin D3, by hydroxylation of the side chain. In regulating the level of vitamin D3, this enzyme plays a role in calcium homeostasis and the vitamin D endocrine system. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
1,25-@dihydroxyvitamin D3 24-hydroxylase|24-OHase|OTTHUMP00000031314|cytochrome P450 family 24 subfamily A polypeptide 1|cytochrome P450, subfamily XXIV (vitamin D 24-hydroxylase)|exo-mitochondrial protein|vitamin D 24-hydroxylase
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com