CYP24A1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant CYP24A1.
Immunogen
CYP24A1 (NP_000773, 415 a.a. ~ 514 a.a) partial recombinant protein with GST tag.
Sequence
LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (86)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — CYP24A1
Entrez GeneID
1591GeneBank Accession#
NM_000782Protein Accession#
NP_000773Gene Name
CYP24A1
Gene Alias
CP24, CYP24, MGC126273, MGC126274, P450-CC24
Gene Description
cytochrome P450, family 24, subfamily A, polypeptide 1
Omim ID
126065Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein initiates the degradation of 1,25-dihydroxyvitamin D3, the physiologically active form of vitamin D3, by hydroxylation of the side chain. In regulating the level of vitamin D3, this enzyme plays a role in calcium homeostasis and the vitamin D endocrine system. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
1,25-@dihydroxyvitamin D3 24-hydroxylase|24-OHase|OTTHUMP00000031314|cytochrome P450 family 24 subfamily A polypeptide 1|cytochrome P450, subfamily XXIV (vitamin D 24-hydroxylase)|exo-mitochondrial protein|vitamin D 24-hydroxylase
-
Interactome
-
Disease
-
Publication Reference
-
A naturally occurring rexinoid, honokiol, can serve as a regulator of various retinoid x receptor heterodimers.
Kotani H, Tanabe H, Mizukami H, Amagaya S, Inoue M.
Biological & Pharmaceutical Bulletin 2012 Jan; 35(1):1.
Application:WB-Ce, Human, HEK 293 cells.
-
Overexpression of ER and VDR is not sufficient to make ER-negative MDA-MB231 breast cancer cells responsive to 1alpha-Hydroxyvitamin D5.
Peng X, Jhaveri P, Hussain-Hakimjee EA, Mehta RG.
Carcinogenesis 2006 Nov; 28(5):1000.
Application:WB, Human, BT474, MDA-MB-231, S-30 cells.
-
A naturally occurring rexinoid, honokiol, can serve as a regulator of various retinoid x receptor heterodimers.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com