Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CYP4A11 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00001579-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human CYP4A11 protein.
  • Immunogen:
  • CYP4A11 (AAH22851, 1 a.a. ~ 215 a.a) full-length human protein.
  • Sequence:
  • MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQSPCPPSHWLFGHIQELQQDQELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKCAFRHWQRAQHSRHLP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CYP4A11 expression in transfected 293T cell line (H00001579-T01) by CYP4A11 MaxPab polyclonal antibody.

    Lane 1: CYP4A11 transfected lysate(23.76 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 1579
  • Gene Name:
  • CYP4A11
  • Gene Alias:
  • CP4Y,CYP4A2,CYP4AII
  • Gene Description:
  • cytochrome P450, family 4, subfamily A, polypeptide 11
  • Gene Summary:
  • This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and hydroxylates medium-chain fatty acids such as laurate and myristate. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000009714,P450HL-omega,alkane-1 monooxygenase,cytochrome P450, subfamily IVA, polypeptide 11,fatty acid omega-hydroxylase,lauric acid omega-hydroxylase
  • RSS
  • YouTube
  • Linkedin
  • Facebook