CYP2J2 monoclonal antibody (M01), clone 2D10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CYP2J2.
Immunogen
CYP2J2 (NP_000766, 408 a.a. ~ 498 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LHRDPTEWATPDTFNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLSLKFRMGITISPVSHRLCA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (85)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.75 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CYP2J2 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — CYP2J2
Entrez GeneID
1573GeneBank Accession#
NM_000775Protein Accession#
NP_000766Gene Name
CYP2J2
Gene Alias
CPJ2
Gene Description
cytochrome P450, family 2, subfamily J, polypeptide 2
Omim ID
601258Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is thought to be the predominant enzyme responsible for epoxidation of endogenous arachidonic acid in cardiac tissue. [provided by RefSeq
Other Designations
OTTHUMP00000010550|arachidonic acid epoxygenase|cytochrome P450, subfamily IIJ (arachidonic acid epoxygenase) polypeptide 2|flavoprotein-linked monooxygenase|microsomal monooxygenase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Posttranslational regulation of CYP2J2 by nitric oxide.
Park JW, Lee CM, Cheng JS, Morgan ET.
Free Radical Biology & Medicine 2018 Jun; 121:149.
Application:WB, Human, Huh7 cells.
-
Investigating the contribution of CYP2J2 to ritonavir metabolism in vitro and in vivo.
Kaspera R, Kirby BJ, Sahele T, Collier AC, Kharasch ED, Unadkat JD, Totah RA.
Biochemical Pharmacology 2014 Sep; 91(1):109.
Application:Quant, Human, Liver microsomes.
-
Cytochrome P450 subfamily 2J polypeptide 2 expression and circulating epoxyeicosatrienoic metabolites in preeclampsia.
Herse F, Lamarca B, Hubel CA, Kaartokallio T, Lokki AI, Ekholm E, Laivuori H, Gauster M, Huppertz B, Sugulle M, Ryan MJ, Novotny S, Brewer J, Park JK, Kacik M, Hoyer J, Verlohren S, Wallukat G, Rothe M, Luft FC, Muller DN, Schunck WH, Staff AC, Dechend R.
Circulation 2012 Dec; 126(25):2990.
Application:IF, WB-Ce, Human, Trophoblast-derived cells, Placental.
-
Identifying a selective substrate and inhibitor pair for the evaluation of CYP2J2 activity.
Lee CA, Jones JP 3rd, Katayama J, Kaspera R, Jiang Y, Freiwald S, Smith E, Walker GS, Totah RA.
Drug Metabolism and Disposition 2012 May; 40(5):943.
Application:WB, Human, Human liver microsomes.
-
Detection of EETs and HETEs-generating Cytochrome P450 Enzymes and the Effects of their Metabolites on Myometrial and Vascular Function.
Pearson T, Warren AY, Barrett DA, Khan RN.
American Journal of Physiology. Endocrinology and Metabolism 2009 Sep; 297(3):E647.
Application:WB, IF, Human, Myometrial tissue.
-
Posttranslational regulation of CYP2J2 by nitric oxide.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com