CYP2C9 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CYP2C9 full-length ORF ( AAH20754.1, 1 a.a. - 162 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKGG
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
43.56
Interspecies Antigen Sequence
Mouse (75); Rat (77)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CYP2C9
Entrez GeneID
1559GeneBank Accession#
BC020754Protein Accession#
AAH20754.1Gene Name
CYP2C9
Gene Alias
CPC9, CYP2C, CYP2C10, MGC149605, MGC88320, P450IIC9
Gene Description
cytochrome P450, family 2, subfamily C, polypeptide 9
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by rifampin. The enzyme is known to metabolize many xenobiotics, including phenytoin, tolbutamide, ibuprofen and S-warfarin. Studies identifying individuals who are poor metabolizers of phenytoin and tolbutamide suggest that this gene is polymorphic. The gene is located within a cluster of cytochrome P450 genes on chromosome 10q24. [provided by RefSeq
Other Designations
OTTHUMP00000020135|cytochrome P-450 S-mephenytoin 4-hydroxylase|cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 10|cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 9|cytochrome p4502C9|flavoprotein-linked mon
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com