CYP1B1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CYP1B1 partial ORF (NP_000095, 453 a.a. - 542 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
NKDLTSRVMIFSVGKRRCIGEELSKMQLFLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKETC
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.64
Interspecies Antigen Sequence
Mouse (77); Rat (78)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CYP1B1
Entrez GeneID
1545GeneBank Accession#
NM_000104Protein Accession#
NP_000095Gene Name
CYP1B1
Gene Alias
CP1B, GLC3A, P4501B1
Gene Description
cytochrome P450, family 1, subfamily B, polypeptide 1
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene localizes to the endoplasmic reticulum and metabolizes procarcinogens such as polycyclic aromatic hydrocarbons and 17beta-estradiol. Mutations in this gene have been associated with primary congenital glaucoma; therefore it is thought that the enzyme also metabolizes a signaling molecule involved in eye development, possibly a steroid. [provided by RefSeq
Other Designations
aryl hydrocarbon hydroxylase|cytochrome P450, subfamily I (dioxin-inducible), polypeptide 1 (glaucoma 3, primary infantile)|flavoprotein-linked monooxygenase|microsomal monooxygenase|xenobiotic monooxygenase
-
Interactome
-
Pathway
-
Disease
- Abortion
- Adenocarcinoma
- Adenoma
- Asperger Syndrome
- Asthma
- Atherosclerosis
- Autistic Disorder
- Brain Neoplasms
- Breast cancer
+ View More Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com