CYP1A2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CYP1A2 partial ORF ( NP_000752, 211 a.a. - 310 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
ESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGNLIPQEKIVNL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CYP1A2
Entrez GeneID
1544GeneBank Accession#
NM_000761Protein Accession#
NP_000752Gene Name
CYP1A2
Gene Alias
CP12, P3-450, P450(PA)
Gene Description
cytochrome P450, family 1, subfamily A, polypeptide 2
Omim ID
124060Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. Other xenobiotic substrates for this enzyme include caffeine, aflatoxin B1, and acetaminophen. The transcript from this gene contains four Alu sequences flanked by direct repeats in the 3' untranslated region. [provided by RefSeq
Other Designations
P450 form 4|aryl hydrocarbon hydroxylase|cytochrome P450, subfamily I (aromatic compound-inducible), polypeptide 2|dioxin-inducible P3-450|flavoprotein-linked monooxygenase|microsomal monooxygenase|xenobiotic monooxygenase
-
Interactome
-
Pathway
-
Disease
- Abortion
- Adenocarcinoma
- Adenoma
- Amyotrophic lateral sclerosis
- Arrhythmia
- Arthritis
- Asthma
- Attention
- Breast cancer
+ View More Disease
-
Publication Reference
-
Simultaneous absolute quantification of 11 cytochrome P450 isoforms in human liver microsomes by liquid chromatography tandem mass spectrometry with In silico target peptide selection.
Kawakami H, Ohtsuki S, Kamiie J, Suzuki T, Abe T, Terasaki T.
Journal of Pharmacological Sciences 2011 Jan; 100(1):341.
Application:WB-Re, Recombinant protein.
-
Simultaneous absolute quantification of 11 cytochrome P450 isoforms in human liver microsomes by liquid chromatography tandem mass spectrometry with In silico target peptide selection.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com