Product Browser

Last updated: 2017/9/17
  • Related Product Showcase
  • By Research Area

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CYLD monoclonal antibody (M01), clone 2C3

  • Catalog # : H00001540-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant CYLD.
  • Immunogen:
  • CYLD (AAH12342, 854 a.a. ~ 953 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • QNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged CYLD is 0.1 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1540
  • Gene Name:
  • CYLD
  • Gene Alias:
  • CDMT,CYLD1,CYLDI,EAC,FLJ20180,FLJ31664,FLJ78684,HSPC057,KIAA0849,MFT,MFT1,SBS,TEM,USPL2
  • Gene Description:
  • cylindromatosis (turban tumor syndrome)
  • Gene Summary:
  • This gene is encodes a cytoplasmic protein with three cytoskeletal-associated protein-glycine-conserved (CAP-GLY) domains that functions as a deubiquitinating enzyme. Mutations in this gene have been associated with cylindromatosis, multiple familial trichoepithelioma, and Brooke-Spiegler syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
  • Other Designations:
  • deubiquitinating enzyme CYLD,ubiquitin carboxyl-terminal hydrolase CYLD,ubiquitin specific peptidase like 2,ubiquitin thiolesterase CYLD,ubiquitin-specific-processing protease CYLD
  • RSS
  • YouTube
  • Linkedin
  • Facebook