Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CYBB (Human) Recombinant Protein (Q01)

  • Catalog # : H00001536-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CYBB partial ORF ( AAH32720, 120 a.a. - 171 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • LFNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 31.46
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001536-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1536
  • Gene Name:
  • CYBB
  • Gene Alias:
  • CGD,GP91-1,GP91-PHOX,GP91PHOX,NOX2,p91-PHOX
  • Gene Description:
  • cytochrome b-245, beta polypeptide
  • Gene Summary:
  • Cytochrome b (-245) is composed of cytochrome b alpha (CYBA) and beta (CYBB) chain. It has been proposed as a primary component of the microbicidal oxidase system of phagocytes. CYBB deficiency is one of five described biochemical defects associated with chronic granulomatous disease (CGD). In this disorder, there is decreased activity of phagocyte NADPH oxidase; neutrophils are able to phagocytize bacteria but cannot kill them in the phagocytic vacuoles. The cause of the killing defect is an inability to increase the cell's respiration and consequent failure to deliver activated oxygen into the phagocytic vacuole. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000031915,cytochrome b-245 beta polypeptide
  • RSS
  • YouTube
  • Linkedin
  • Facebook