Product Browser

Last updated: 2017/4/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CX3CR1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00001524-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human CX3CR1 protein.
  • Immunogen:
  • CX3CR1 (NP_001328.1, 1 a.a. ~ 355 a.a) full-length human protein.
  • Sequence:
  • MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKFRRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Application Image
  • Gene Information
  • Entrez GeneID:
  • 1524
  • Gene Name:
  • CX3CR1
  • Gene Alias:
  • CCRL1,CMKBRL1,CMKDR1,GPR13,GPRV28,V28
  • Gene Description:
  • chemokine (C-X3-C motif) receptor 1
  • Other Designations:
  • G protein-coupled receptor 13,chemokine (C-C) receptor-like 1,chemokine (C-X3-C) receptor 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook