CUX1 monoclonal antibody (M01J), clone 2A10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CUX1 expression in transfected 293T cell line by CUX1 monoclonal antibody (M01J), clone 2A10.
Lane 1: CUX1 transfected lysate (Predicted MW: 77.2 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CUX1 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B. [antibody concentration 5 ug/ml]
Immunoprecipitation
Immunoprecipitation of CUX1 transfected lysate using anti-CUX1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CUX1 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CUX1 is 0.03 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to CUX1 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CUX1.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
CUX1 (NP_001904.2, 521 a.a. ~ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (50)
Preparation Method
Cell Culture Production
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CUX1 expression in transfected 293T cell line by CUX1 monoclonal antibody (M01J), clone 2A10.
Lane 1: CUX1 transfected lysate (Predicted MW: 77.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CUX1 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B. [antibody concentration 5 ug/ml]Immunoprecipitation
Immunoprecipitation of CUX1 transfected lysate using anti-CUX1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CUX1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CUX1 is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CUX1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — CUX1
Entrez GeneID
1523GeneBank Accession#
NM_001913Protein Accession#
NP_001904.2Gene Name
CUX1
Gene Alias
CASP, CDP, CDP/Cut, CDP1, COY1, CUTL1, CUX, Clox, Cux/CDP, GOLIM6, Nbla10317, p100, p110, p200, p75
Gene Description
cut-like homeobox 1
Omim ID
116896Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the homeodomain family of DNA binding proteins. It may regulate gene expression, morphogenesis, and differentiation and it may also play a role in the cell cycle progession. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq
Other Designations
cut homeobox|cut homolog|cut-like 1, CCAAT displacement protein|golgi integral membrane protein 6|putative protein product of Nbla10317
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com