Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CTSK (Human) Recombinant Protein (Q01)

  • Catalog # : H00001513-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CTSK partial ORF ( AAH16058, 220 a.a. - 329 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.95
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001513-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1513
  • Gene Name:
  • CTSK
  • Gene Alias:
  • CTS02,CTSO,CTSO1,CTSO2,MGC23107,PKND,PYCD
  • Gene Description:
  • cathepsin K
  • Gene Summary:
  • The protein encoded by this gene is a lysosomal cysteine proteinase involved in bone remodeling and resorption. This protein, which is a member of the peptidase C1 protein family, is predominantly expressed in osteoclasts. However, the encoded protein is also expressed in a significant fraction of human breast cancers, where it could contribute to tumor invasiveness. Mutations in this gene are the cause of pycnodysostosis, an autosomal recessive disease characterized by osteosclerosis and short stature. This gene may be subject to RNA editing. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000032938,cathepsin O1,cathepsin O2,cathepsin X
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook