Product Browser

Last updated: 2017/7/16

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CTNND1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00001500-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CTNND1 partial ORF ( AAH10501, 721 a.a. - 830 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • WGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNKTLDRSGDLGDMEPLKGTTPLMQKI
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001500-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1500
  • Gene Name:
  • CTNND1
  • Gene Alias:
  • CAS,CTNND,KIAA0384,P120CAS,P120CTN,p120
  • Gene Description:
  • catenin (cadherin-associated protein), delta 1
  • Gene Summary:
  • This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and althernative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined. [provided by RefSeq
  • Other Designations:
  • catenin, delta 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook