NKX2-5 monoclonal antibody (M01), clone 1E4-G5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant NKX2-5.
Immunogen
NKX2-5 (AAH25711, 1 a.a. ~ 324 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAW
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (61.38 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
NKX2-5 monoclonal antibody (M01), clone 1E4-G5. Western Blot analysis of NKX2-5 expression in human thyroid(diffuse hyperplasia).Western Blot (Cell lysate)
NKX2-5 monoclonal antibody (M01), clone 1E4-G5 Western Blot analysis of NKX2-5 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of NKX2-5 expression in transfected 293T cell line by NKX2-5 monoclonal antibody (M01), clone 1E4-G5.
Lane 1: NKX2-5 transfected lysate(34.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NKX2-5 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — NKX2-5
Entrez GeneID
1482GeneBank Accession#
BC025711Protein Accession#
AAH25711Gene Name
NKX2-5
Gene Alias
CHNG5, CSX, CSX1, NKX2.5, NKX2E, NKX4-1
Gene Description
NK2 transcription factor related, locus 5 (Drosophila)
Gene Ontology
HyperlinkGene Summary
Homeobox-containing genes play critical roles in regulating tissue-specific gene expression essential for tissue differentiation, as well as determining the temporal and spatial patterns of development (Shiojima et al., 1995 [PubMed 7665173]). It has been demonstrated that a Drosophila homeobox-containing gene called 'tinman' is expressed in the developing dorsal vessel and in the equivalent of the vertebrate heart. Mutations in tinman result in loss of heart formation in the embryo, suggesting that tinman is essential for Drosophila heart formation. Furthermore, abundant expression of Csx, the presumptive mouse homolog of tinman, is observed only in the heart from the time of cardiac differentiation. CSX, the human homolog of murine Csx, has a homeodomain sequence identical to that of Csx and is expressed only in the heart, again suggesting that CSX plays an important role in human heart formation.[supplied by OMIM
Other Designations
NK2 transcription factor homolog E|NK2 transcription factor related, locus 5|cardiac-specific homeo box|tinman paralog
-
Interactome
-
Disease
-
Publication Reference
-
Complex SUMO-1 Regulation of Cardiac Transcription Factor Nkx2-5.
Costa MW, Lee S, Furtado MB, Xin L, Sparrow DB, Martinez CG, Dunwoodie SL, Kurtenbach E, Mohun T, Rosenthal N, Harvey RP.
PLoS One 2011 Sep; 6(9):e24812.
Application:IP, WB-Tr, Human, Mouse, Cardiac HL-1, HEK 293T cells.
-
RNA toxicity in myotonic muscular dystrophy induces NKX2-5 expression.
Yadava RS, Frenzel-McCardell CD, Yu Q, Srinivasan V, Tucker AL, Puymirat J, Thornton CA, Prall OW, Harvey RP, Mahadevan MS.
Nature Genetics 2007 Dec; 40(1):61.
Application:WB, Mouse, Mouse skeletal muscle.
-
Complex SUMO-1 Regulation of Cardiac Transcription Factor Nkx2-5.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com