CSTF3 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CSTF3 full-length ORF ( AAH09792, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEVTILFYFFLYQYCSIHCSDRKQVRNIAN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.07
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CSTF3
Entrez GeneID
1479GeneBank Accession#
BC009792Protein Accession#
AAH09792Gene Name
CSTF3
Gene Alias
CSTF-77, MGC117398, MGC43001, MGC75122
Gene Description
cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa
Omim ID
600367Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is one of three (including CSTF1 and CSTF2) cleavage stimulation factors that combine to form the cleavage stimulation factor complex (CSTF). This complex is involved in the polyadenylation and 3' end cleavage of pre-mRNAs. The encoded protein functions as a homodimer and interacts directly with both CSTF1 and CSTF2 in the CSTF complex. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
CSTF 77 kDa subunit|cleavage stimulation factor subunit 3|cleavage stimulation factor subunit 3, isoform 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com