CSTF3 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (37.44 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length recombinant CSTF3.
Immunogen
CSTF3 (AAH09792, 1 a.a. ~ 103 a.a) full-length recombinant protein with GST tag.
Sequence
MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEVTILFYFFLYQYCSIHCSDRKQVRNIAN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.44 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — CSTF3
Entrez GeneID
1479GeneBank Accession#
BC009792Protein Accession#
AAH09792Gene Name
CSTF3
Gene Alias
CSTF-77, MGC117398, MGC43001, MGC75122
Gene Description
cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa
Omim ID
600367Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is one of three (including CSTF1 and CSTF2) cleavage stimulation factors that combine to form the cleavage stimulation factor complex (CSTF). This complex is involved in the polyadenylation and 3' end cleavage of pre-mRNAs. The encoded protein functions as a homodimer and interacts directly with both CSTF1 and CSTF2 in the CSTF complex. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
CSTF 77 kDa subunit|cleavage stimulation factor subunit 3|cleavage stimulation factor subunit 3, isoform 1
-
Interactome
-
Publication Reference
-
Type 2 Diabetes Biomarkers and Uses Thereof.
Eustache Paramithiotis, Marc Prentki, Rèmi Rabasa-lhoret, Pascal Croteau, Joel Lanoix, Murthy S. R. Madiraju, Érik Joly
United States Patent Application Publication 2015 Nov; [Epub].
Application：IF, WB, Human, Mouse, Rat, Islets, INS832/13, MIN6 cells.
-
Type 2 Diabetes Biomarkers and Uses Thereof.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com