Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CSTF3 polyclonal antibody (A01)

  • Catalog # : H00001479-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant CSTF3.
  • Immunogen:
  • CSTF3 (AAH09792, 1 a.a. ~ 103 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEVTILFYFFLYQYCSIHCSDRKQVRNIAN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001479-A01
    Western Blot detection against Immunogen (37.44 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1479
  • Gene Name:
  • CSTF3
  • Gene Alias:
  • CSTF-77,MGC117398,MGC43001,MGC75122
  • Gene Description:
  • cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa
  • Gene Summary:
  • The protein encoded by this gene is one of three (including CSTF1 and CSTF2) cleavage stimulation factors that combine to form the cleavage stimulation factor complex (CSTF). This complex is involved in the polyadenylation and 3' end cleavage of pre-mRNAs. The encoded protein functions as a homodimer and interacts directly with both CSTF1 and CSTF2 in the CSTF complex. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
  • Other Designations:
  • CSTF 77 kDa subunit,cleavage stimulation factor subunit 3,cleavage stimulation factor subunit 3, isoform 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook