CSTB monoclonal antibody (M02), clone M2-F1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CSTB monoclonal antibody (M02), clone M2-F1 Western Blot analysis of CSTB expression in A-431 ( Cat # L015V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of CSTB expression in transfected 293T cell line by CSTB monoclonal antibody (M02), clone M2-F1.
Lane 1: CSTB transfected lysate(11 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CSTB on formalin-fixed paraffin-embedded human colon tissue. [antibody concentration 5 ug/ml]
Immunofluorescence
Immunofluorescence of monoclonal antibody to CSTB on A-431 cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant CSTB.
Immunogen
CSTB (AAH03370.1, 1 a.a. ~ 98 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CSTB monoclonal antibody (M02), clone M2-F1 Western Blot analysis of CSTB expression in A-431 ( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of CSTB expression in transfected 293T cell line by CSTB monoclonal antibody (M02), clone M2-F1.
Lane 1: CSTB transfected lysate(11 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CSTB on formalin-fixed paraffin-embedded human colon tissue. [antibody concentration 5 ug/ml]ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CSTB on A-431 cell. [antibody concentration 10 ug/ml] -
Gene Info — CSTB
Entrez GeneID
1476GeneBank Accession#
BC003370.1Protein Accession#
AAH03370.1Gene Name
CSTB
Gene Alias
CST6, EPM1, PME, STFB
Gene Description
cystatin B (stefin B)
Gene Ontology
HyperlinkGene Summary
The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and kininogens. This gene encodes a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in this gene are responsible for the primary defects in patients with progressive myoclonic epilepsy (EPM1). [provided by RefSeq
Other Designations
CPI-B|cystatin B|liver thiol proteinase inhibitor|stefin B
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com