CST5 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CST5 protein.
Immunogen
CST5 (NP_001891.2, 1 a.a. ~ 142 a.a) full-length human protein.
Sequence
MMWPMHTPLLLLTALMVAVAGSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (42); Rat (47)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CST5 expression in transfected 293T cell line (H00001473-T01) by CST5 MaxPab polyclonal antibody.
Lane 1: CST5 transfected lysate(15.62 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CST5
Entrez GeneID
1473GeneBank Accession#
NM_001900.4Protein Accession#
NP_001891.2Gene Name
CST5
Gene Alias
MGC71922
Gene Description
cystatin D
Omim ID
123858Gene Ontology
HyperlinkGene Summary
The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a protein found in saliva and tears. The encoded protein may play a protective role against proteinases present in the oral cavity. [provided by RefSeq
Other Designations
OTTHUMP00000030448|cystatin 5|cysteine-proteinase inhibitor
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com