CST3 MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CST3 protein.
Immunogen
CST3 (NP_000090.1, 1 a.a. ~ 146 a.a) full-length human protein.
Sequence
MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CST3 expression in transfected 293T cell line (H00001471-T01) by CST3 MaxPab polyclonal antibody.
Lane 1: CST3 transfected lysate(16.06 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CST3
Entrez GeneID
1471GeneBank Accession#
NM_000099.2Protein Accession#
NP_000090.1Gene Name
CST3
Gene Alias
ARMD11, MGC117328
Gene Description
cystatin C
Gene Ontology
HyperlinkGene Summary
The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes the most abundant extracellular inhibitor of cysteine proteases, which is found in high concentrations in biological fluids and is expressed in virtually all organs of the body. A mutation in this gene has been associated with amyloid angiopathy. Expression of this protein in vascular wall smooth muscle cells is severely reduced in both atherosclerotic and aneurysmal aortic lesions, establishing its role in vascular disease. [provided by RefSeq
Other Designations
OTTHUMP00000030440|OTTHUMP00000164181|OTTHUMP00000164182|bA218C14.4 (cystatin C)|cystatin 3|cystatin C (amyloid angiopathy and cerebral hemorrhage)|gamma-trace|neuroendocrine basic polypeptide|post-gamma-globulin
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com